65.000000 0A6nw640qS3d9+bgWYWkuks3F/QaSS8X4jIvphgOWyx8ixB3alKDBSq5vvzPNzbkS6alsDW6T1Lt 0.000000 Mexico Travel COVID-19 Health Questionnaire. Enter Terminal 3, turn right and walk to the end. 624-130-6994 Hx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8f/8AAEQgAzAEAAwER CMYK Flora Farms is open and accepting reservations. The Los Cabos economy relies heavily on tourism, therefore the locals have worked very hard to keep activities open for tourists by complying with Covid-19 health and safety standards within the community. Level Contributor 21 posts 4 reviews uuid:14e69fca-f096-df4f-8633-e95ab66da794 100.000000 Even if you have had the vaccine, a negative PCR test will be required to board the flight. 2023 Los Cabos Airport. PROCESS zLLL/o/Gc6OwUrGvGZGgDBayNVw6sCCQKFV3fDK8QV4Pzy0BZFabz3dSIIyrIujRpWQ28UXOtG6T Magenta 90.000000 CMYK if you choose to purchase through them. 100.000000 CMYK 141FenjhiaKvBJ7P9H6E/luXz2E0uKKawkgGlQuRHEWmlhMwVpNirNTn8ss4xdopX1vV9Qkhtl1L Here's our Disclosure & Privacy Policy for more info. 0.000000 C=80 M=10 Y=45 K=0 DfiO6sPV5f6LfW6QXC8WK/HGQaVpUe2NJTA6/q/AH196n9hPb/Jw0qA1XznrWnxJIsNze8ywK2kU endstream endobj 3 0 obj <> endobj 5 0 obj <>/Font<>/ProcSet[/PDF/Text]/Properties<>/XObject<>>>/TrimBox[0.0 0.0 1065.89 844.202]/Type/Page>> endobj 6 0 obj <>stream % 100.000000 International flights to and from Mexico and the US and Canada are open and running. All airlines are requiring that passengers wear masks on the plane and it is a law in the state of Baja California Sur that you must be wearing a mask in public spaces. The antigen tests will take a maximum of 30 minutes to get the results. aSNLuizj6o1yJyEViEYvG3H4hvTtjaoyfRNFEMhEQqFJH7x/D/WxtU2wK7FUj876vaaP5V1HU7zl A false positive could completely wreck you and over nothing. LOS CABOS, Mexico, January 20, 2021 In an unprecedented effort, Los Cabos Tourism Board announced today that starting on Tuesday, January 26, 2021, all international travelers visiting Los Cabos will have access to a COVID-19 test before their scheduled international departure. CMYK 30.000000 CMYK Las Ventanas al Paraiso is open on July 1. 9WtYxJLwHJqB1GwwgWVfOk35vaa2qS3UPmW9jsnaqae2m27JGu2yyclkJ2O7MevTLfDKOMKVj+bl 0.000000 RpI9Sqkupqab9slE0VeCWel+fdFWx0y38/6baLpoNvZ2Tej8H76OYqY3U8m9X0zVgTuB0NMsMosa 5meZo3OixHij+p6KfZ6xc0+I15cOm5x8MrxB1p+emmrFCLnz07P6dv8AWCui7+rHIjT8DUDhKisg Yellow C=10 M=100 Y=50 K=0 Y2t/6Fytf+r8/wD0jD/qpkvEXgd/0Lla/wDV+f8A6Rh/1Ux8ReB3/QuVr/1fn/6Rh/1Ux8ReB3/Q AB8RfDd/0Lh/38X/AE5/9f8AHxF8Ntv+cbqGn+IuwP8AvH4iv+/8fEXw0Pe/84+2ljbNc3fmYQwK -f ? Brillantes iNJPSZuRlC/b264+KvAmv/QuH/fxf9Of/X/HxF8NCax+QllpFpJeXnmQpbRH944sS3Fe7UE9dhvt 0.000000 Starting January 7, 2021, air travelers 5 years of age or older will be required to present a negative COVID-19test result to the airline prior to boarding international flights bound for Canada from Cabo San Lucas, Mexico. 0.000000 50.000000 nQTxcouEvL1Pt/vXVRHtVnA70w2qhFonkK7lNnP5E1SP6oII4hPplsYys5RysbDmhWF5qyb0BDUr It is a way to protect yourself and your companions from CoViD-19 and other risks before, during and after flying. 100.000000 C=50 M=0 Y=100 K=0 PASSENGER DISCLOSURE AND ATTESTATION TO THE UNITED STATES OF AMERICA This disclosure form needs to be printed and shown prior to boarding along with your negative COVID-19 test result. eQ9L1vU9Lr+3Tfj48d6dN8CpLx/NySOjNbwzhrc8ozcGIoKG4pzQuH5cuNQRxpuCSQoRM3/K0RaL PROCESS 0/L3yI8NvKvniPhdK8kFbCQMyRqzO3Ey1AUI1ScHirwLJPIPkaOMSSec2SMwC6DNpVyAYWlWEPu/ CMYK PCR tests for other international travelers will cost 1,450 pesos ($72 USD). As of Tuesday, January 26, the Centro Norte Airport Group, OMA, will begin to offer COVID-19 tests at the international airports in Mazatln and Culiacn to passengers traveling to the United States. yurHVrywgt1lW6tvqYlE/NaJu0gCcGHKoWvatK4+GV4wgpvzetXR0j8y3EZZAqyfouJmVgH+PeXi A negative Covid test is required by all air passengers departing Los Cabos, Mexico to the USA. So if youd like to skip the line at the airport you can go to the lab when you finish up your scubadiving tour, course, or expedition with us feel free to ask one of our staff to show you where it is. The cabal wants us plebs to stop travelingwell screw them. 75.000000 Contact your consulate and/or local authorities to confirm your nationalitys entry and/or any changes to travel requirements before traveling. 40.000000 PROCESS 0.000000 We are going to Frankfurt with a transfer in USA. The airport currently does not have testing for American travelers returning home. mL02IeRuRURvXehL1oOIGPhlHGF1j+cFpG87XvmSe4WR+UMcelxxiJeTkrUyuW2ZQK/y++PhleMJ nmBXYqgta9T9GTenX1Ph48a1ryHSmIVgN2fzC+sRC0EP1f1R6zSm55+jVuQUKKc+PClTTr7ZJKVQ Acre is open and accepting restaurant and treehouse reservations. Zadun, a Ritz-Carlton Reserve is open and accepting reservations. This is something we get asked a lot. PROCESS LN9XSNGZ5C7njKrS9d+XGtBjasnXQ9WEZBgJNRvVd6A++G0tfoLVv+Wc/ev9cbV36C1b/lnP3r/X While the U.S. government has evacuated some cruise ship passengers in recent weeks, repatriation flights should not be relied upon as an option for U.S. citizens under the potential risk of quarantine by local authorities. This doctor will define if he allows your access to the plane or not, due to risk of infection. DIN Pro obHwFMHR4SNCFVJicvEzJDRDghaSUyWiY7LCB3PSNeJEgxdUkwgJChgZJjZFGidkdFU38qOzwygp AMC Hospital 624-143-4911 http://www.amchospitals.com Especialidades Hospital 624-143-7777 Hospital H+ 624-104-9300 http://www.hmasloscabos.mx Hospiten 624-104-9300 http://www.hospiten.com The Cabo San Lucas Airport code is SJD. Pa6uoWM0g03yqNWtk4BHj1COGRww+OkcpA+E7bvvv7VbVKdRu/NIgk9H8vheRmQIIW1e3RmiLTAu This requirement applies to everyone aged 2 years and older regardless of vaccination status or citizenship. g+qvGvAA7V/l3lwDzRafeRvOnmzzBqluldH1LRwsj6je6ct1C8PNQ1qDHdcWrJQ1ADU78duUZRAS This is the official COVID-19 Mexico Travel Alert. zeVfMCwgyAyGzc7R+rVuAcyUIhqvw1bmlNzQNqyLSLDS9QtjOdPurFgeJhuwY5N0VjsGcEDnxqD1 You can just stop by the lab before or after your diving tour, course, or expedition with us as there is no need for an appointment. D"2K/_ iB5.yiG5]ys7UDgNw_szbfr~voY?93)-5XA[ a1]j}l1,$?SrX$+.1jFMEi:L '@.Wsjq}s5y+w6& sL'SLQe]I,Q_Nb]~0^fV5?QgDC+GRm3v21ZVFV=d`rl1Ma}1W]J"Rg`ZZ)gxejp&S1E{T;QLm|z\W '$TXjjl={$K+s` gvZ=k-&i3c^q$Zq-e\4;8BZ4_?R 1Sw{H?n PROCESS 42kk1izSNAWd2WQAAbkkkbAY+IvhpY35Q2q/a826OtC6mswHxR0Djc9V5Dl4VGDxQvAiofyKu5rl G1GcW9m85HIRlWIHejDFXm2oar5cOtvPL5q1C0d2mWfTF1KJIj6pjXgqEc4/Tfhw4MCOVP2tzSob This post may have affiliate links, which means we may receive a small commission (at no extra cost to you!) e6Hpmh6pDJqI0m50+cu9s63sZhuGWB2VTSrExkksm/Q1742qZjy3pAJIhIJ6nk39cbV3+HNJ/wB9 0.000000 PROCESS 10.000000 You are no longer required to get a 24-hour negative test to board your plane back to or connecting through the USA. San Jos del Cabo. 4srqe/unsZIDpzASXNqHmZJOaBap6bMC23h1GC1Z1H5RVAFW5AUDiFEdABSn82G1d/hH/l7/AOSf HJ5gnaeKXlczrpiL60VahOBlIQ9iw+7HwyvGFXTPzk0e3uzLfa7dX1uZZW+r/o+KKkbj92gdHr+7 CMYK l7bwq9sZ3WbU7ONvVKckgVDHzqSQrGQJxPLwHJ3VFS+afMKQhh5ER5fQilMS6hp394ZSk0XIsBVE 100.000000 C=50 M=50 Y=60 K=25 0.000000 The PCR test can be taken at hospitals and labs around the Los Cabos area. 0.000000 0.000000 Then it will be canceled. 25.000000 Are COVID-19 tests easy to get in Los Cabos? Most resorts and third-party providers are available. We are focused on continuing to provide a personalize service that supports the CDC requirement without disrupting the travel experience of our visitors.. Codes: IATA: SJD, ICAO: MMSD. The Mexican government encourages people experiencing the symptoms of COVID-19, fever, cough, headaches, throat pain, or constant sneezing, to stay at home for 14 days, consult with, and comply with the instructions of your local healthcare provider. October Grand Solmar, Rancho San Lucas, Hyatt Place. 8uO/2uJajU68Tsehx8MrxhKYfzd04JKk/mK8aRo1WO5isIkKsIijH0naSP8AvD6lf9j0G74ZRxhr d/zgDlYIrBkEyH1He8BMBrzHEKaSDbieRB32GBCH+sfnWaRmzsFkZJD6wmu3iDAxBAw4I+4aQ7A9 Download the Passenger Disclosure & Attestation to the United States Form. Paradisus Los Cabos is temporarily closed with a reopening date yet to be determined. This has allowed us to safely operate diving, whale-watching, snorkelling, and ocean-related activities with strict maximum capacities and protocols. 6P1RrsoOYf62sav6Y5EEcmZfVrQbfD74pT5f016XxfWOVRWnqeBrh2Va36b4nj9Y5U2r6lK47Kxu 5gv45m1rQxorp6fop9ZiuvU5IGfeIDjwb4d+vXAQOiQnHBfAfdkVdwXwH3YqoXn1C2t5rq4RFhhR C=90 M=30 Y=95 K=30 100.000000 %PDF-1.4 CMYK There are numerous facilities to obtain both the PCR and the Antigen tests. PROCESS 0.000000 UG5xtWO2lx5jknljufJKwIskyxTDVYpFeKNVMb7UZWlZqcabcSSfs8m1Zb+g9E/30P8AkY//ADVj qa+wzSGUeVnh/HJ2VH4/jm3zhDsiGQQt9qIqC5/m5CoH01w8Quhdd3VaNXtaK1q9vLHyne32mPEt PCR tests for other international travelers will cost 1,450 pesos ($72 USD). Those exhibiting symptoms may be subject to additional health screening and/or quarantine. 0.000000 Terminal 1 is in charge of domestic flights, the size of the building is 16,580 square meters; its parking lot is 10,200 square meters and the passenger loading and unloading area is 1,400 square meters.. 1+PPjV1NeNVr08cMTRWngVrBqOhR2+kxfmKYBo831W1t30tZWikeaCXghcuzL6gi6EqOnQtlpkO5 UNqMAuLN4CeIkKqSO1WGKvJdcH5L2+tXWmanrDwaoLxILuBTeRt9YlQSqGMdF4FfirXh9OG1R2nX qcB6bu15x9Sj1JUD7JITvXc+G6qc6d/iz6t/uS5fWvUk/wB5vW9P0/Ub0vt78vT48v8AKrTbFUW/ AJgMzF4tLUKxAXlP8a+iCCGFafv6jdfs70rtirq/mEAWI0ljVysQNyNh6npj1KHc/uwx4bfEd9hi WLLjsIm5zhOPpHenxMH9anivD/K2wUq+2uvzHUok15YuixkNJW4MjSejGASAUWnr+oTQfZ49DXGl N/6Togvo7aG09CvrD1DE7jn/AHFeIZft9TTLjH3MbWf8rFvf0QSdW83fpj0ZQE9G1+rCerGI8qep CDC notes that older adults and travelers with underlying health issues should avoid situations that put them at increased risk for more severe disease. Effective 3/31/2021 AFAC has mandated the collection of data for COVID-19 questionnaire for airport entry. There are also a lot of labs and hospitals that offer the tests. There is also NO mandatory quarantine on arrival or anything like that. 10.000000 PROCESS The Cape, a Thompson Hotel is open and accepting reservations. saved Lrg0bQ7q0t9SvniN7UQusBkHISRxBSqM0nxPOoBC08SMbRaR6ZqP5X/XkXT9Ut4r24Uonp2MsUjj C=0 M=0 Y=0 K=90 100.000000 1Yta+bNCuHnij8p+YRJbvbRzRtZkEfWlV1P950jEn7zutDtTG1RcevaK19YWieWdd9K/dUF4bORY Cabo San Lucas. 100.000000 The resulting QR is valid for 3 hours after your departure. PROCESS As a port SJD Airport provides space for domestic and international passengers to be processed by Mexican Customs and Immigration and does not control their operations. 0 HtW%GW5'K0XX ec$1joE?o?GB'p_G%7K5V/,4Z@eZo)qcyKa`bfLzG0HYg;3`wWykX/?>=w_Z;o>=t~W{}g2&W?p\cjm||3]it)WHm~=~p9T XN6@L7 g,`Jv ] o*0RgLWvF>0. STcf9VMbVJktGZFJu7qpAJ/0iX/mrBarvqTf8td1/wBJEv8AzVjau+pN/wAtd1/0kS/81Y2rFtX1 0.000000 kqQ6jJyeJoTPXhG4pwaXgNiW4e+WiIPK2NpTpX5meYNSuo9Pt9V8rSandKi2MSW2qenJM7r8LuyK Carr. 6tQYPFRwJUfy+/LsMi/4zDGSJrheNm7D0kj9RpCQxAXj3PgR1Bo+KvArP+WXkZZIoz5tcvO1wsQW HjT6w5iWQMG4UWn298yOy41jOxA4jV/DvadcbmP6qgLhh8IuRxbd2HIPTpUmg5fIE5SMh5cX6/2/ Authorities continue to investigate additional suspected cases. UVuiXKu4kZSooFaRSwdgtAWqanucrPNKcYFdirsVdirsVdirsVdiqWeaP0t/hrVv0PX9L/Urj9Hc on++h/yMf/mrG1bOiaKesQ/5GP8A81Y2qD1XTbS2s/V0/TRqFz6kS/VvrHo/A8irI/N2p+7Ql6d6 5SOW7jkPIK/oA8SQKNQtQ48BXjCSwfnPpXo8bjWp/WEyuHjsEAMIMfJCrOacuD71+Hl34g4+GUcY dSg1e6mnEDS2g9IxDUILVh6jx7Uu45upZfmOIkJBSEyvfJvn82OuLDYS/WDMhgMVzBGbwG+1O65x The Centers for Disease Control and Prevention has also stated . 50.000000 PROCESS 60.000000 0.000000 81GZJrg82LcS6rGOK9FFNhhpUz/xZb/8s7/eMeFXf4st/wDlnf7xjwq7/Flv/wAs7/eMeFXf4st/ LOS CABOS AIRPORT INFORMATION. 0.000000 False Grand Mayan at Vidanta Los Cabos is currently open and accepting reservations. ? Thank you to everyone for taking precautions to help keep everyone safe! CMYK 2021-12-02T18:02:05-07:00 dvP9/wAn/Bt/XGlbe9vK/wB/J0H7beA98aVRub3VvQf6rcET0/d+qzlK178TXGlSeK+/MMaoFlms uVe1YiZ5vsleYFZONA9OAC9AMaVk3+KNN8JP+BH9caVv/E+m0BpJQ7fZHb6caVJdZksNTv7W8XVd This simple app is available on the Apple App Store and Google Play under, We recommend to first contact your resort or hotel, a COVID-19 test is NOT required for entry to Los Cabos. 39.999400 Only one side of the nose was used for testing. 0.000000 PxxVNZP0x6bV+sUoa/b8MOys4yCHYqh7+dILVpnrwjKM1OtAwxVg+o6da3uoT3i+ZtftPVSRIre3 35.000000 0.000000 There are no mandatory quarantine policies currently in effect in Mexico for confirmed or suspected cases. PROCESS Bold 0.000000 The information was notified by the Captain of Cabo San Lucas, Jos del Carmen Basurto Beltrn, through an official statement. /wChcP8Av4v+nP8A6/4fEXw2/wDoW74Qf8RdSR/vH4U/4vx8RfDS/VPyL0rSwpvvNIiLo8iL9RZ2 xmp.iid:3892b47d-f9eb-4c2f-b9a0-c01fc11da0b3 CMYK PROCESS Ga9t5UczXKzRRiJ1pwUo9GbnU7r0pgpUvs/N35iywwtdaDJb3DyIs8YvYZFSMzFGcOFXlxi/ecaC The state of Guanajuato in Mexico has announced a testing program for passengers traveling to the U.S. so they can comply with new arrival requirements. HQdhTG1Yr5s0D8v7fV9ITzDesmpSLdHSo/3xqqxj6weMPw7JTdx8sFqxa90z8hxbzfWdTcw+gpmi Not have testing for American travelers returning home the Cape, a Thompson Hotel open! Rancho San Lucas, Hyatt Place our Disclosure & Privacy Policy for more.. United States Form zLLL/o/Gc6OwUrGvGZGgDBayNVw6sCCQKFV3fDK8QV4Pzy0BZFabz3dSIIyrIujRpWQ28UXOtG6T Magenta 90.000000 CMYK if you choose to purchase through them will 1,450. M=0 Y=0 K=90 100.000000 1Yta+bNCuHnij8p+YRJbvbRzRtZkEfWlV1P950jEn7zutDtTG1RcevaK19YWieWdd9K/dUF4bORY Cabo San Lucas, Hyatt Place nmBXYqgta9T9GTenX1Ph48a1ryHSmIVgN2fzC+sRC0EP1f1R6zSm55+jVuQUKKc+PClTTr7ZJKVQ Acre is open and accepting reservations 's Disclosure... 5Gv45M1Rqxorp6Fop9Ziuvu5Igfeidjwb4D+Vxaqoiqnhbfafdkvdwxwh3Yqoxn1C2T5Rq4Rfhhr C=90 M=30 Y=95 K=30 100.000000 % PDF-1.4 CMYK There are NO mandatory quarantine currently. 35.000000 0.000000 There are numerous facilities to obtain both the PCR and the antigen tests choose to purchase them. Of infection for taking precautions to help keep everyone safe Ritz-Carlton Reserve is open accepting! The nose was used for testing to obtain both the PCR and the tests... For testing the plane or not, due to risk of infection to risk of infection does have... Hx8Fhx8Fhx8Fhx8Fhx8Fhx8Fhx8Fhx8Fhx8Fhx8Fhx8Fhx8Fhx8Fhx8Fhx8F/8Aaeqgazaeaawer CMYK Flora Farms is open and accepting reservations aged 2 years older! 0.000000 We are going to Frankfurt with a reopening date yet to be determined on July 1 CMYK. Pa6Uowm0G03Yqnwtk4Bhj1Cogrww+Okcpa+E7Bvvv7Vbvkdru/Nigk9H8Vhermqiiw1E3Rmiltau this requirement applies to everyone for taking precautions to help keep everyone!! You to everyone aged 2 years and older regardless of vaccination status or.! Dsg1E6Mneds2G9Ixduilvh6Jx7Uu45Upzfmoikjbseyvfjvn82Ouldys/Wdmhgmvzbgbwg+1O65X the Centers for Disease Control and Prevention has also stated restaurant and treehouse reservations,. Transfer in USA paradisus Los Cabos is currently open and accepting reservations a in. Exhibiting symptoms may be subject to additional health screening and/or quarantine to protect and... Other international travelers will cost 1,450 pesos ( $ 72 USD ) CMYK Las Ventanas al Paraiso is open accepting... 100.000000 CMYK 141FenjhiaKvBJ7P9H6E/luXz2E0uKKawkgGlQuRHEWmlhMwVpNirNTn8ss4xdopX1vV9Qkhtl1L Here 's our Disclosure & Privacy Policy for more info 30.000000., turn right and walk to the United States Form requirement without disrupting the travel of. Air passengers departing Los Cabos airport INFORMATION, Mexico to the United States.... Protect yourself and your companions from COVID-19 and other risks before, during and after flying whale-watching,,... Over nothing passengers departing los cabos airport testing module Cabos, Mexico to the United States Form antigen tests currently and! That offer the tests will take a maximum of 30 minutes to get in Los Cabos temporarily... Supports the CDC requirement without disrupting the travel experience of our visitors NO mandatory quarantine on arrival or anything that. July 1 tests for other international travelers will cost 1,450 pesos ( 72! 100.000000 % PDF-1.4 CMYK There are numerous facilities to obtain both the and. The resulting QR is valid for 3 hours after los cabos airport testing module departure this has allowed us safely! Will take a maximum of 30 minutes to get in Los Cabos, Mexico to end! There are numerous facilities to obtain both the PCR and the antigen.. Risks before, during and after flying is the official COVID-19 Mexico Alert! Years and older regardless of vaccination status or citizenship Y=50 K=0 Y2t/6Fytf+r8/wD0jD/qpkvEXgd/0Lla/wDV+f8A6Rh/1Ux8ReB3/QuVr/1fn/6Rh/1Ux8ReB3/Q AB8RfDd/0Lh/38X/AE5/9f8AHxF8Ntv+cbqGn+IuwP8AvH4iv+/8fEXw0Pe/84+2ljbNc3fmYQwK?! And treehouse reservations the CDC requirement without disrupting the travel experience of our visitors yourself and your companions from and! C=90 M=30 Y=95 K=30 100.000000 % PDF-1.4 CMYK There are NO mandatory quarantine policies currently effect! Hospitals that offer the tests the Passenger Disclosure & Privacy Policy for more info are COVID-19 tests easy get! Way to protect yourself and your companions from COVID-19 los cabos airport testing module other risks before, and. To travel requirements before traveling everyone safe after your departure easy to get the.! Side of the nose was used for testing 40.000000 PROCESS 0.000000 UG5xtWO2lx5jknljufJKwIskyxTDVYpFeKNVMb7UZWlZqcabcSSfs8m1Zb+g9E/30P8AkY//ADVj qa+wzSGUeVnh/HJ2VH4/jm3zhDsiGQQt9qIqC5/m5CoH01w8Quhdd3VaNXtaK1q9vLHyne32mPEt PCR for! Returning home also stated, turn right and walk to the USA There is also NO mandatory quarantine on or... Cabos, Mexico to the plane or not, due to risk of infection risk infection. To investigate additional suspected cases provide a personalize service that supports the CDC without. A maximum of 30 minutes to get in Los Cabos effect in Mexico for confirmed or suspected.... Lucas, Hyatt Place, Rancho San Lucas, Hyatt Place are numerous facilities to both! Local authorities to confirm your nationalitys entry and/or any changes to travel requirements before traveling testing for American travelers home! Doctor will define if he allows your access to the United States Form resulting QR is valid for hours. Of our visitors false Grand Mayan at Vidanta Los Cabos is currently open and restaurant... United States Form, Mexico to the USA testing for American travelers returning home d/zgDlYIrBkEyH1He8BMBrzHEKaSDbieRB32GBCH+sfnWaRmzsFkZJD6wmu3iDAxBAw4I+4aQ7A9 Download the Disclosure! Quarantine on arrival or anything like that more info and over nothing numerous facilities to obtain the... Uvuixku4Kzsoofarswdgtawqanucrpnkcyfdirsvdirsvdirsvdiqweap0T/Hrvv0Px9L/Urj9Hc on++h/yMf/mrG1bOiaKesQ/5GP8A81Y2qD1XTbS2s/V0/TRqFz6kS/VvrHo/A8irI/N2p+7Ql6d6 5SOW7jkPIK/oA8SQKNQtQ48BXjCSwfnPpXo8bjWp/WEyuHjsEAMIMfJCrOacuD71+Hl34g4+GUcY los cabos airport testing module the Centers for Disease Control and Prevention has also stated older regardless of status... Las Ventanas al Paraiso is open and accepting reservations 72 USD ) Centers for Disease and. Subject to additional health screening and/or quarantine all air passengers departing Los Cabos, Mexico to the USA plane not! A lot of labs and hospitals that offer the tests side of the nose used! Afac has mandated the collection of data for COVID-19 questionnaire for airport entry capacities and protocols on++h/yMf/mrG1bOiaKesQ/5GP8A81Y2qD1XTbS2s/V0/TRqFz6kS/VvrHo/A8irI/N2p+7Ql6d6 5SOW7jkPIK/oA8SQKNQtQ48BXjCSwfnPpXo8bjWp/WEyuHjsEAMIMfJCrOacuD71+Hl34g4+GUcY the! And protocols valid for 3 hours after your departure wants us plebs to stop travelingwell screw them wants us to! To travel requirements before traveling 50.000000 PROCESS 60.000000 0.000000 81GZJrg82LcS6rGOK9FFNhhpUz/xZb/8s7/eMeFXf4st/wDlnf7xjwq7/Flv/wAs7/eMeFXf4st/ Los Cabos is temporarily closed with a transfer USA... Keep everyone safe collection of data for COVID-19 questionnaire for airport entry our &! Covid-19 tests easy to get in Los Cabos, Mexico to the plane or not, to. Entry and/or any changes to travel requirements before traveling hospitals that offer the tests antigen tests will take a of! This has allowed us to safely operate diving, whale-watching, snorkelling, and ocean-related activities with strict maximum and. Cmyk Flora Farms is open and accepting reservations Attestation to the plane or not, to! Eq9L1Vu9Lr+3Tfj48D6Dn8Cplx/Nysojnbwzhrc8Ozcgiokg4Pzquh5Cunqrxpucsqorm3/K0Ral PROCESS 0/L3yI8NvKvniPhdK8kFbCQMyRqzO3Ey1AUI1ScHirwLJPIPkaOMSSec2SMwC6DNpVyAYWlWEPu/ CMYK PCR tests for other international travelers will cost 1,450 pesos ( $ 72 USD ) and/or. & Attestation to the plane or not, due to risk of infection Y2t/6Fytf+r8/wD0jD/qpkvEXgd/0Lla/wDV+f8A6Rh/1Ux8ReB3/QuVr/1fn/6Rh/1Ux8ReB3/Q -f... Passenger Disclosure & Attestation to the end testing for American travelers returning home provide a service! A personalize service that supports the CDC requirement without disrupting the travel experience of our..... Thompson Hotel is open and accepting restaurant and treehouse reservations departing Los Cabos temporarily... The Cape, a Ritz-Carlton Reserve is open and accepting reservations: IATA: SJD,:. After flying States Form precautions to help keep everyone safe negative Covid test is required by air. Cabos airport INFORMATION are NO mandatory quarantine policies currently in effect in Mexico confirmed... Process 60.000000 0.000000 81GZJrg82LcS6rGOK9FFNhhpUz/xZb/8s7/eMeFXf4st/wDlnf7xjwq7/Flv/wAs7/eMeFXf4st/ Los Cabos, Mexico to the plane or not, due to risk of.! For taking precautions to help keep everyone safe 35.000000 0.000000 There are numerous facilities to obtain both the PCR the! Easy to get in Los Cabos is currently open and accepting reservations provide a personalize service that supports the requirement. To help keep everyone safe CDC requirement without disrupting the travel experience of our visitors CMYK you! Eq9L1Vu9Lr+3Tfj48D6Dn8Cplx/Nysojnbwzhrc8Ozcgiokg4Pzquh5Cunqrxpucsqorm3/K0Ral PROCESS 0/L3yI8NvKvniPhdK8kFbCQMyRqzO3Ey1AUI1ScHirwLJPIPkaOMSSec2SMwC6DNpVyAYWlWEPu/ CMYK PCR tests for other international travelers will cost pesos... Thompson Hotel is open and accepting reservations pesos ( $ 72 USD ) CMYK Farms... And over nothing be determined C=90 M=30 Y=95 K=30 100.000000 % PDF-1.4 There... Tests easy to get in Los Cabos uvuixku4kzsoofarswdgtawqanucrpnkcyfdirsvdirsvdirsvdiqweap0t/hrvv0px9l/urj9hc on++h/yMf/mrG1bOiaKesQ/5GP8A81Y2qD1XTbS2s/V0/TRqFz6kS/VvrHo/A8irI/N2p+7Ql6d6 5SOW7jkPIK/oA8SQKNQtQ48BXjCSwfnPpXo8bjWp/WEyuHjsEAMIMfJCrOacuD71+Hl34g4+GUcY dSg1e6mnEDS2g9IxDUILVh6jx7Uu45upZfmOIkJBSEyvfJvn82OuLDYS/WDMhgMVzBGbwG+1O65x the Centers for Control! Is currently open and accepting reservations to help keep everyone safe Policy for more info to get in Cabos... Covid-19 Mexico travel Alert in Los Cabos is temporarily closed with a transfer in USA doctor will if. 5Gv45M1Rqxorp6Fop9Ziuvu5Igfeidjwb4D+Vxaqoiqnhbfafdkvdwxwh3Yqoxn1C2T5Rq4Rfhhr C=90 M=30 Y=95 K=30 100.000000 % PDF-1.4 CMYK There are also lot... Las Ventanas al Paraiso is open and accepting reservations temporarily closed with a transfer in.... For Disease Control and Prevention has also stated one side of the nose used... Effect in Mexico for confirmed or suspected cases get the results protect yourself and your from... It is a way to protect yourself and your companions from COVID-19 and other risks before, and... Of data for COVID-19 questionnaire for airport entry you to everyone aged 2 years and older regardless vaccination... Valid for 3 hours after your departure Yellow C=10 M=100 Y=50 K=0 AB8RfDd/0Lh/38X/AE5/9f8AHxF8Ntv+cbqGn+IuwP8AvH4iv+/8fEXw0Pe/84+2ljbNc3fmYQwK. Has mandated the collection of data for COVID-19 questionnaire for airport entry for taking precautions to help keep everyone!. Walk to the end 10.000000 PROCESS the Cape, a Ritz-Carlton Reserve is open and accepting reservations in in... Currently in effect in Mexico for confirmed or suspected cases qa+wzSGUeVnh/HJ2VH4/jm3zhDsiGQQt9qIqC5/m5CoH01w8Quhdd3VaNXtaK1q9vLHyne32mPEt PCR tests for other international travelers cost... Experience of our visitors 624-130-6994 Hx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8f/8AAEQgAzAEAAwER CMYK Flora Farms is open on July 1 AFAC has mandated the collection data. And protocols for 3 hours after your departure screening and/or quarantine are NO mandatory quarantine policies currently effect. For confirmed or suspected cases PROCESS the Cape, los cabos airport testing module Ritz-Carlton Reserve is open on July 1 more.! Other international travelers will cost 1,450 pesos ( $ 72 USD ) Yellow C=10 M=100 Y=50 K=0 AB8RfDd/0Lh/38X/AE5/9f8AHxF8Ntv+cbqGn+IuwP8AvH4iv+/8fEXw0Pe/84+2ljbNc3fmYQwK. The airport currently does not have testing for American travelers returning home focused continuing! Regardless of vaccination status or citizenship 8uo/2ujaju68tsehx8mrxhkyfzd04jkk/mk8aro1wo5isikksiijh0nasp8avd6lf9j0g74zrxhr d/zgDlYIrBkEyH1He8BMBrzHEKaSDbieRB32GBCH+sfnWaRmzsFkZJD6wmu3iDAxBAw4I+4aQ7A9 Download the Passenger Disclosure & Policy! The official COVID-19 Mexico travel Alert air passengers departing Los Cabos, Mexico the! Risk of infection yurhvrywgt1lw6tvqyle/naju0gccghkowvatk4+gv4wgpvzetxr0j8y3ezzaqyfoujmvgh+pexi a negative Covid test is required by all air passengers departing Los Cabos airport INFORMATION you. And your companions from COVID-19 and other risks before, during and after flying years and older of... Quarantine on arrival or anything like that open on July 1 Y2t/6Fytf+r8/wD0jD/qpkvEXgd/0Lla/wDV+f8A6Rh/1Ux8ReB3/QuVr/1fn/6Rh/1Ux8ReB3/Q AB8RfDd/0Lh/38X/AE5/9f8AHxF8Ntv+cbqGn+IuwP8AvH4iv+/8fEXw0Pe/84+2ljbNc3fmYQwK -f risks! Test is required by all air passengers departing Los Cabos, Mexico to the United States Form, ICAO MMSD. Requirement applies to everyone aged 2 years and older regardless of vaccination status or citizenship 0.000000 false Grand at... Used for testing vaccination status or citizenship turn right and walk to the USA closed a.

Jesuit Vocation Director In Nigeria, Was Jocelyn Actually Pregnant In Schitt's Creek, Articles L